Steps - Fold
To fold a protein, we will use the following amino acid sequence as an example, lets use the insulin:
MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTFollow these steps to fold the protein:
The confirmation modal will appear, where you can optionally add or remove configurations.
By confirming, the sequence will enter an initial "Pending" state, with processing time depending on the number of requested foldings. Below, we show you the state flow of this process.

When the result is Complete, it means the results are ready to be reviewed by accessing the corresponding job.
If the result is Error, it is recommended to relaunch the job.
In these cases, it is also advisable to contact our support team to ensure a better experience and resolve any issues.
To better understand the results, we will first review some essential basic concepts. Then, we will guide you step by step on how to analyze them.
Last updated
Was this helpful?
