Scientists and AI agents doing real science.
Why use Fastfold
- Scientists + agents: collaborate with AI agents to plan, run, and iterate on folding experiments.
- Managed infrastructure: run jobs on cloud GPUs and containers without handling DevOps yourself.
- Reproducibility first: keep runs versioned and traceable so results are easy to compare and share.
- Production-ready integrations: use REST endpoints directly or ship quickly with the Python SDK and CLI.
Python SDK
For scripting, notebooks, and CI pipelines, use the Python SDK directly.
pip install fastfold-aifrom fastfold import Client
client = Client()
my_job = client.fold.create(
sequence="[LL-37, 37 aa]",
model="boltz-2",
is_public=True,
)
results = client.jobs.wait_for_completion(my_job.id, poll_interval=5.0, timeout=900.0)
print("Status:", results.job.status)
print("CIF URL:", results.cif_url())
print("Viewer:", results.get_viewer_link())This creates a fold job, waits for completion, then prints the job status, a direct CIF artifact URL, and a viewer link.
All integration paths
- Agent CLI (natural language research agent): /agent-cli
- PyMOL Agent (in-app structure workflows): /pymol-agent
- Python SDK guide: /python-sdk
- Practical SDK recipes: /python-examples
- Terminal / CI scripting: /cli
- REST API reference: /api
Skills for agents
If you use AI agents, install the official Fastfold skills package to help agents run fold workflows end-to-end (create job, wait for completion, fetch CIF/PDB, metrics, and viewer links).
npx skills add fastfold-ai/skillsThe repository currently includes a fold skill focused on Fastfold Jobs API automation, and supports loading FASTFOLD_API_KEY from .env for local scripting.
- Skills repo: github.com/fastfold-ai/skills
- Skills listing: skills.sh/fastfold-ai/skills
- Detailed guide: /skills
Fastfold Agent CLI
The fastest way to get started is the Fastfold Agent CLI — ask questions in natural language and get data-backed answers powered by 190+ domain tools and Fastfold AI Cloud.
uv tool install "fastfold-agent-cli[all]" --python 3.10# Authenticate (interactive wizard)
fastfold setup
# Ask a question
fastfold "Fold this sequence with boltz-2 and show me the binding pockets: MALWMRLLPLL..."Full install guide, interactive mode, and all commands → Agent CLI
Fastfold PyMOL Agent
Bring Fastfold skills directly into PyMOL with a chat-driven plugin workflow.
curl -LsSf http://fastfold.ai/pymol-agent/install.sh | shInstall, setup, and usage guide → PyMOL Agent
llms.txt
This docs site includes AI-friendly exports:
/llms.txt: concise index with documentation links./llms-full.txt: full combined markdown content.
You can also append .mdx to docs paths to retrieve markdown content for a specific page (for example, /python-sdk.mdx).
Next steps
Create an API key in the dashboard, run a first fold, then choose your integration path:
- API-first: /api
- SDK/CLI-first: /quick-start
Last updated on