Fastfold Docs
Fastfold

Scientists and AI agents doing real science.

Skillsfastfold-ai on PyPIfastfold-agent-cli on PyPIJoin Slack

Why use Fastfold

  • Scientists + agents: collaborate with AI agents to plan, run, and iterate on folding experiments.
  • Managed infrastructure: run jobs on cloud GPUs and containers without handling DevOps yourself.
  • Reproducibility first: keep runs versioned and traceable so results are easy to compare and share.
  • Production-ready integrations: use REST endpoints directly or ship quickly with the Python SDK and CLI.

Python SDK

For scripting, notebooks, and CI pipelines, use the Python SDK directly.

pip install fastfold-ai
from fastfold import Client

client = Client()

my_job = client.fold.create(
    sequence="[LL-37, 37 aa]",
    model="boltz-2",
    is_public=True,
)

results = client.jobs.wait_for_completion(my_job.id, poll_interval=5.0, timeout=900.0)
print("Status:", results.job.status)
print("CIF URL:", results.cif_url())
print("Viewer:", results.get_viewer_link())

This creates a fold job, waits for completion, then prints the job status, a direct CIF artifact URL, and a viewer link.

All integration paths

Agent Skills

If you use AI agents, install the official Fastfold skills package to help agents run fold workflows end-to-end (create job, wait for completion, fetch CIF/PDB, metrics, and viewer links).

npx skills add fastfold-ai/skills

The repository currently includes a fold skill focused on Fastfold Jobs API automation, and supports loading FASTFOLD_API_KEY from .env for local scripting.

Agent CLI

The fastest way to get started is the Agent CLI — ask questions in natural language and get data-backed answers powered by 190+ domain tools and Fastfold AI Cloud.

uv tool install "fastfold-agent-cli[all]" --python 3.10
# Authenticate (interactive wizard)
fastfold setup

# Ask a question
fastfold "Fold this sequence with boltz-2 and show me the binding pockets: MALWMRLLPLL..."

Full install guide, interactive mode, and all commands → Agent CLI

Agent PyMOL

Bring Fastfold skills directly into PyMOL with a chat-driven plugin workflow.

curl -LsSf http://fastfold.ai/pymol-agent/install.sh | sh

Install, setup, and usage guide → PyMOL Agent

llms.txt

This docs site includes AI-friendly exports:

You can also append .mdx to docs paths to retrieve markdown content for a specific page (for example, /python-sdk.mdx).

Next steps

Create an API key in the dashboard, run a first fold, then choose your integration path:

Last updated on

On this page