Create Job
Create a new job to fold protein sequences using AI models. The job will be processed asynchronously and you can track its status using the returned job ID.
Authorization
bearerAuth Bearer token authentication. Use your API key with:
Authorization: Bearer <YOUR_API_KEY>
In: header
Query Parameters
Optional library item ID to associate with this job
uuidRequest Body
application/json
Job creation request with sequences and parameters
Name of the job
Whether the job results should be publicly accessible
falseList of sequences to fold
1 <= itemsOptional pocket and bond constraints in the job JSON. Boltz, Boltz-2, and IntelliFold
apply these during inference (YAML). Chai-1 maps contact, pocket, and bond into native restraints
CSV rows. OpenFold 3 does not use constraints in its inference input
(only sequences and chain-level modifications); values may still be stored on the job for
the UI or replay.
Optional chat ID to associate with this job
uuidResponse Body
application/json
application/json
application/json
application/json
curl -X POST "https://api.fastfold.ai/v1/jobs" \ -H "Content-Type: application/json" \ -d '{ "name": "My Boltz-2 Affinity Job", "isPublic": false, "sequences": [ { "proteinChain": { "sequence": "MTEYKLVVVGACGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKE" } }, { "ligandSequence": { "sequence": "U4U", "is_ccd": true, "property_type": "affinity" } } ], "params": { "modelName": "boltz-2" } }'{
"jobId": "550e8400-e29b-41d4-a716-446655440000",
"jobRunId": "660e8400-e29b-41d4-a716-446655440001",
"jobName": "My Protein Fold",
"jobStatus": "INITIALIZED",
"sequencesIds": [
"770e8400-e29b-41d4-a716-446655440002"
]
}{
"message": "Invalid sequence format"
}{
"message": "Unauthorized"
}{
"message": "Daily quota exceeded. Limit: 30 calls per day. Current: 30 calls."
}Last updated on